Choose the brand aligned with your industry so we can best serve your needs.
For researchers, scientists, and technical professionals: Your one-stop shop for the complete range of laboratory, production, and safety products and services.
Conventional ImmunoGold Reagents are monodisperse size population makes the conjugates suited for multiple labeling with no overlap. The Conventional Immunogold Reagents are the classical conjugates in immuno electron microscopy; they are a good choice when the antigen is abundant and the accessibility of the antigen is relatively good.
The conventional labeling approach in transmission and scanning electron microscopy utilizes secondary immunogold reagents based on particles that can be observed without enhancement. The particle population is monodisperse and thus shows minimal size variation and overlap.
The reagents are supplied in PBS with 1% Bovine Serum Albumin and 15 mM NaN3. Particle size: EM-grade 6 nm
Encompass Procurement Services Non-distribution item offered as a customer accommodation; additional freight charges may apply. Learn More
A very long-chain fatty acid methyl ester; has been found in transesterified palm oil, biodiesel produced by the microalga Botryococcus, and in sediment samples from Lake Kivu in the EAst African rift valley
Encompass Procurement Services Non-distribution item offered as a customer accommodation; additional freight charges may apply. Learn More
Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) · To be used in conjunction with Cayman’s EP4 Receptor Polyclonal Antibody (Item No. 101775) to block protein-antibody complex formation during immunochemical analysis for the EP4 receptor.
Encompass Procurement Services Non-distribution item offered as a customer accommodation; additional freight charges may apply. Learn More